Loading Control

 

St John's Laboratory offers a variety of primary polyclonal and monoclonal antibodies. With numerous cited primary and secondary antibodies available from our catalogue of more than 30,000 antibodies we have you covered for your western blot, immunofluorescence, ELISA and other assay needs. So whether you are after rabbit monoclonals, goat polyclonals or ELISA kits, we provide coverage for the majority of research areas.

 

Browse secondary antibodies

Browse ELISA kits

 

Browse polyclonal antibodies

Browse monoclonal antibodies

Browse by research area

Featured Products

Feature Product - Anti-Beta Actin Antibody (STJ96930)

Feature Product - Anti-Beta Actin primary antibody (STJ96930)

Mouse monoclonal Anti-Beta Actin primary antibody with 4 reviews over 4-star, covering multiple applications and multiple species, at high dilution.

IHC Guaranteed Antibodies

IHC-Guarantee primary antibodies

We have selected a wide range of IHC-validated primary antibodies suitable for immunohistochemistry applications, covering pathology, cancer research, immunology and other usual biomarkers.

  Loading Controls

Loading controls

Loading control primary antibodies target proteins which typically exhibit ubiquitous expression. There use is valuable in determining relative protein concentration and in determining the successful transfer of protein in western blots.

Rabbit Monoclonals

Rabbit monoclonals

Primary rabbit monoclonal antibodies can exhibit a greater binding affinity to antigens than those from rodents such as mice. Using rabbit monoclonal antibodies is particularly advantageous for more accurate immunohistochemistry results.

Phospho Antibodies

Phospho-antibodies

Protein phosphorylation plays a significant role in a wide range of post-translational cellular processes including cell growth and proliferation, metabolism, physiological regulation and cell signalling.

Knockout

KO-validated antibodies

        In a knockout validation, antibody specificity is confirmed by testing the antibody of interest against a sample from a tissue or cell line which does not express the protein of interest as well as a positive control which does.

Goat Primary Antibodies

Goat primary antibodies

Goat primary antibodies are ideal for large scale projects at a low cost. We have over 3000 goat primary antibodies suitable for various applications.

Tag antibodies

Tag antibodies

Tag antibodies are frequently used with recombinant protein cell cultures to allow researchers to selectively extract a target protein from the endogenous samples. One of the most popular is our Anti-mCherry-Tag antibody used widely in gene expression assays.

Host

Currently Filter by:

Category: Neuronal System
Product Type: KO Validated
  1. Rabbit (10)
Conjugation

Currently Filter by:

Category: Neuronal System
Product Type: KO Validated
  1. Unconjugated (10)
Clonality

Currently Filter by:

Category: Neuronal System
Product Type: KO Validated
  1. Polyclonal (10)
Applications

Currently Filter by:

Category: Neuronal System
Product Type: KO Validated
  1. ICC (7)
  2. IF (1)
  3. IHC (9)
  4. IP (4)
  5. WB (10)
Reactivity

Currently Filter by:

Category: Neuronal System
Product Type: KO Validated
  1. Human (9)
  2. Mouse (9)
  3. Rat (8)
Isotype

Currently Filter by:

Category: Neuronal System
Product Type: KO Validated
  1. IgG (2)
  • Anti-HCN4 Antibody [STJ80525]

    GST fusion protein with sequence HGHLHDSAEERRLIAEGDASPG EDRTPPGLAAEPERP, corresponding to amino acid residues 119-155 of human HCN4 (Accession ) (MW: 31 kDa.). Intracellular, N-terminus.GST fusion protein with sequence HGHLHDSAEERRLIAEGDASPG EDRTPPGLAAEPE
    Clonality: Polyclonal
    Host: Rabbit
    Reactivity: Human, Mouse, Rat
    Applications: ICC, IHC, IP, WB
    Compare 
    Rating:
    0Publications
  • Anti-KCNK2 Antibody [STJ80522]

    Peptide DPKSAAQNSKPRLSFSTK(C), corresponding to residues 8-25 of human KCNK2 (Accession ). Intracellular, N-terminus.Peptide DPKSAAQNSKPRLSFSTK(C), corresponding to residues 8-25 of human KCNK2 (Accession ). Intracellular, N-terminus.
    Clonality: Polyclonal
    Host: Rabbit
    Reactivity: Human, Mouse, Rat
    Applications: ICC, IHC, WB
    Compare 
    Rating:
    0Publications
  • Anti-HCN2 Antibody [STJ80510]

    Peptide (C)EEAGPAGEPRGSQAS, corresponding to amino acid residues 147-161 of human HCN2 (Accession ). Intracellular, N-terminus.Peptide (C)EEAGPAGEPRGSQAS, corresponding to amino acid residues 147-161 of human HCN2 (Accession ). Intracellular, N-terminus.
    Clonality: Polyclonal
    Host: Rabbit
    Reactivity: Human, Mouse, Rat
    Applications: ICC, IHC, IP, WB
    Compare 
    Rating:
    0Publications
  • Anti-KCNJ5 Antibody [STJ80508]

    Peptide RNAMNQDMEIGVT(C), corresponding to amino acid residues 6-18 of rat Kir3.4 (Accession ). Intracellular, N-terminus.Peptide RNAMNQDMEIGVT(C), corresponding to amino acid residues 6-18 of rat Kir3.4 (Accession ). Intracellular, N-terminus.
    Clonality: Polyclonal
    Host: Rabbit
    Reactivity: Human, Mouse, Rat
    Applications: ICC, IHC, WB
    Compare 
    Rating:
    0Publications
  • Anti-KCNN3 Antibody [STJ80506]

    Peptide DTSGHFHDSGVGDLDEDPKC, corresponding to amino acid residues 2-21 of human KCNN3 (Accession ). Intracellular, N-terminus.Peptide DTSGHFHDSGVGDLDEDPKC, corresponding to amino acid residues 2-21 of human KCNN3 (Accession ). Intracellular, N-terminus.
    Clonality: Polyclonal
    Host: Rabbit
    Reactivity: Human, Mouse, Rat
    Applications: ICC, IHC, WB
    Compare 
    Rating:
    0Publications
  • Anti-KV3.1b Antibody [STJ80497]

    Peptide CKESPVIAKYMPTEAVRVT, corresponding to amino acid residues 567-585 of rat KV3.1b (Accession ). Intracellular, C-terminus.Peptide CKESPVIAKYMPTEAVRVT, corresponding to amino acid residues 567-585 of rat KV3.1b (Accession ). Intracellular, C-terminus
    Clonality: Polyclonal
    Host: Rabbit
    Reactivity: Mouse, Rat
    Applications: ICC, IHC, IP, WB
    Compare 
    Rating:
    0Publications
  • Anti-GIRK1 Antibody [STJ80490]

    GST fusion protein with sequence LQRISSVPGNSEEKLVSKT TKMLSDPMSQSVADLPPKLQKMAGGPTRMEGNLPAKLRKM NSDRFT, corresponding to residues 437-501 of mouse GIRK1 (Accession ) (MW: 34 kDa.). Intracellular, C-terminus.GST fusion protein with sequence LQRISSVPGNSEEKLVS
    Clonality: Polyclonal
    Host: Rabbit
    Reactivity: Human, Mouse, Rat
    Applications: ICC, IHC, IP, WB
    Compare 
    Rating:
    0Publications
  • Anti-PANX1 Antibody [STJ80116]

    Peptide (C)KEPTEPKFKGLRLE, corresponding to amino acid residues 18- 31 of human PANX1 (Accession ). Intracellular, N-terminus.Peptide (C)KEPTEPKFKGLRLE, corresponding to amino acid residues 18- 31 of human PANX1 (Accession ). Intracellular, N-terminus.
    Clonality: Polyclonal
    Host: Rabbit
    Reactivity: Human, Mouse, Rat
    Applications: IHC, WB
    Compare 
    Rating:
    0Publications
  • Anti-GNAI3 Antibody [STJ115271]

    Western blot analysis of extracts of various cell lines, using GNAI3 antibody (STJ115271) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in T
    Clonality: Polyclonal
    Host: Rabbit
    Reactivity: Human
    Applications: WB
    Compare 
    Rating:
    0Publications
  • Anti-GLUL Antibody [STJ27390]

    Western blot analysis of extracts of various cell lines, using GLUL antibody (STJ27390) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBS
    Clonality: Polyclonal
    Host: Rabbit
    Reactivity: Human, Mouse
    Applications: IF, IHC, WB
    Compare 
    Rating:
    0Publications