Loading Control


St John's Laboratory offers a variety of primary polyclonal and monoclonal antibodies. With numerous cited primary and secondary antibodies available from our catalogue of more than 30,000 antibodies we have you covered for your western blot, immunofluorescence, ELISA and other assay needs. So whether you are after rabbit monoclonals, goat polyclonals or ELISA kits, we provide coverage for the majority of research areas.


Browse secondary antibodies

Browse ELISA kits


Browse polyclonal antibodies

Browse monoclonal antibodies

Browse by research area

Featured Products

Feature Product - Anti-Beta Actin Antibody (STJ96930)

Feature Product - Anti-Beta Actin primary antibody (STJ96930)

Mouse monoclonal Anti-Beta Actin primary antibody with 4 reviews over 4-star, covering multiple applications and multiple species, at high dilution.

IHC Guaranteed Antibodies

IHC-Guarantee primary antibodies

We have selected a wide range of IHC-validated primary antibodies suitable for immunohistochemistry applications, covering pathology, cancer research, immunology and other usual biomarkers.

  Loading Controls

Loading controls

Loading control primary antibodies target proteins which typically exhibit ubiquitous expression. There use is valuable in determining relative protein concentration and in determining the successful transfer of protein in western blots.

Rabbit Monoclonals

Rabbit monoclonals

Primary rabbit monoclonal antibodies can exhibit a greater binding affinity to antigens than those from rodents such as mice. Using rabbit monoclonal antibodies is particularly advantageous for more accurate immunohistochemistry results.

Phospho Antibodies


Protein phosphorylation plays a significant role in a wide range of post-translational cellular processes including cell growth and proliferation, metabolism, physiological regulation and cell signalling.


KO-validated antibodies

        In a knockout validation, antibody specificity is confirmed by testing the antibody of interest against a sample from a tissue or cell line which does not express the protein of interest as well as a positive control which does.

Goat Primary Antibodies

Goat primary antibodies

Goat primary antibodies are ideal for large scale projects at a low cost. We have over 3000 goat primary antibodies suitable for various applications.

Tag antibodies

Tag antibodies

Tag antibodies are frequently used with recombinant protein cell cultures to allow researchers to selectively extract a target protein from the endogenous samples. One of the most popular is our Anti-mCherry-Tag antibody used widely in gene expression assays.


Currently Filter by:

Product Type: KO Validated
Host: Rabbit
  1. Research Area (162)
  2. Polyclonal Antibodies (162)

Currently Filter by:

Product Type: KO Validated
Host: Rabbit
  1. Human (158)
  2. Mouse (144)
  3. Rat (105)
  4. Simian (1)

Currently Filter by:

Product Type: KO Validated
Host: Rabbit
  1. IgG (131)

Currently Filter by:

Product Type: KO Validated
Host: Rabbit

Currently Filter by:

Product Type: KO Validated
Host: Rabbit
  1. Unconjugated (162)

Currently Filter by:

Product Type: KO Validated
Host: Rabbit
  1. Polyclonal (162)
  1. 1
  2. 2
  3. 3
  4. 4
  5. 5
  • Anti-EIF2AK2 Antibody [STJ27547]

    Western blot analysis of extracts of various cell lines, using Eif2ak2 antibody (STJ27547) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in
    Clonality: Polyclonal
    Host: Rabbit
    Reactivity: Human, Mouse
    Applications: IF, IHC, WB
  • Anti-YAP1 Antibody [STJ26137]

    Western blot analysis of extracts of various cell lines, using YAP1 antibody (STJ26137) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBS
    Clonality: Polyclonal
    Host: Rabbit
    Reactivity: Human, Mouse, Rat
    Applications: IF, IHC, IP, WB
  • Anti-RAB27A Antibody [STJ25258]

    Western blot analysis of extracts of U-937 cells, using RAB27A antibody (STJ25258) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. De
    Clonality: Polyclonal
    Host: Rabbit
    Reactivity: Human, Mouse
    Applications: IF, IHC, WB
  • Anti-IL18 Antibody [STJ24170]

    Western blot analysis of extracts of various cell lines, using IL18 antibody (STJ24170) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBS
    Clonality: Polyclonal
    Host: Rabbit
    Reactivity: Human, Mouse, Rat
    Applications: WB
  • Anti-AIFM1 Antibody [STJ22557]

    Western blot analysis of extracts of various cell lines, using AIFM1 antibody (STJ22557) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TB
    Clonality: Polyclonal
    Host: Rabbit
    Reactivity: Human, Mouse
    Applications: IF, IHC, WB
  • Anti-NaV1.6 Antibody [STJ80682]

    Peptide CIANHTGVDIHRNGDFQKNG, corresponding to amino acid residues 1042-1061 of rat NaV1.6 (Accession ). Intracellular loop between domains II and III.Peptide CIANHTGVDIHRNGDFQKNG, corresponding to amino acid residues 1042-1061 of rat NaV1.6 (Accession ).
    Clonality: Polyclonal
    Host: Rabbit
    Reactivity: Human, Mouse, Rat
    Applications: ICC, IHC, WB
  • Anti-Aquaporin 3 Antibody [STJ80660]

    Peptide (C)STEAENVKLAHMKHKEQI, corresponding to amino acid residues 275-292 of rat AQP3 (Accession ). Intracellular, C-terminus.Peptide (C)STEAENVKLAHMKHKEQI, corresponding to amino acid residues 275-292 of rat AQP3 (Accession ). Intracellular, C-terminus
    Clonality: Polyclonal
    Host: Rabbit
    Reactivity: Human, Mouse, Rat
    Applications: FC, IHC, IP, WB
  • Anti-PSD-93 Antibody [STJ80637]

    GST fusion protein with a sequence VEDDYTRPPEPVYSTVNKLCDKPASPRHYSPVECDKSFLLSTPY, corresponding to amino acid residues 336-379 of rat Chapsyn-110 (Accession ). Between PDZ2 and PDZ3 domains.GST fusion protein with a sequence VEDDYTRPPEPVYSTVNKLCDKPASPRHYSP
    Clonality: Polyclonal
    Host: Rabbit
    Reactivity: Mouse, Rat
    Applications: ICC, IHC, IP, WB
  • Anti-P2X7 Receptor (ECD) Antibody [STJ80598]

    Peptide KKGWMDPQSKGIQTGRC, corresponding to amino acid residues 136-152 of mouse P2X7 receptor (Accession number ). Extracellular loop.Peptide KKGWMDPQSKGIQTGRC, corresponding to amino acid residues 136-152 of mouse P2X7 receptor (Accession number ). Extr
    Clonality: Polyclonal
    Host: Rabbit
    Reactivity: Human, Mouse, Rat
    Applications: FC, ICC, IHC, Live Cell Imaging, WB
  • Anti-P2X7 Receptor Antibody [STJ80595]

    Peptide (C)KIRKEFPKTQGQYSGFKYPY, corresponding to amino acid residues 576-595 of rat P2X7 receptor (Accession ). Intracellular, C-terminus.Peptide (C)KIRKEFPKTQGQYSGFKYPY, corresponding to amino acid residues 576-595 of rat P2X7 receptor (Accession ). Int
    Clonality: Polyclonal
    Host: Rabbit
    Reactivity: Human, Mouse, Rat
    Applications: FC, ICC, IHC, IP, WB
  • Anti-P2X4 Receptor Antibody [STJ80593]

    Peptide (C)KKYKYVEDYEQGLSGEMNQ, corresponding to amino acid residues 370-388 of rat P2X4 receptor (Accession ). Intracellular, C-terminus.Peptide (C)KKYKYVEDYEQGLSGEMNQ, corresponding to amino acid residues 370-388 of rat P2X4 receptor (Accession ). Intra
    Clonality: Polyclonal
    Host: Rabbit
    Reactivity: Human, Mouse, Rat
    Applications: FC, ICC, IHC, IP, WB
  • Anti-P2X1 Receptor Antibody [STJ80592]

    Peptide (CS)DPVATSSTLGLQENMRTS, corresponding to amino acid residues 382-399 of rat P2X1 receptor (Accession ). Intracellular, C-terminus.Peptide (CS)DPVATSSTLGLQENMRTS, corresponding to amino acid residues 382-399 of rat P2X1 receptor (Accession ). Intra
    Clonality: Polyclonal
    Host: Rabbit
    Reactivity: Human, Mouse, Rat
    Applications: FC, ICC, IHC, IP, WB
  1. 1
  2. 2
  3. 3
  4. 4
  5. 5